CCDC107 Rabbit Polyclonal Antibody

SKU TA334806

Rabbit Polyclonal Anti-CCDC107 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCDC107 antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC107. Synthetic peptide located within the following region: NMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: coiled-coil domain containing 107
• Database Link:
  NP_777583
  Q8WV48
• Background: This gene encodes a membrane protein which contains a coiled-coil domain in the central region. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: PSEC0222
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane