CCDC107 (NM_174923) Human Recombinant Protein

SKU
TP305865
Recombinant protein of human coiled-coil domain containing 107 (CCDC107), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205865 protein sequence
Red=Cloning site Green=Tags(s)

MAGAVSLLGVVGLLLVSALSGVLGDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGSLPLGA
LYTAAVAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQTEQHLNNLMAQLDPLFERVTT
LAGAQQELLNMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISPHTEASRPLPED
FCLKEDEEEVGDSQAWEEPTNWSTETWNLATSWEVGRGLRRRCSQAVAKGPSHSLGWEGGTTAEGRLKQS
LFS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_777583
Locus ID 203260
UniProt ID Q8WV48
Cytogenetics 9p13.3
RefSeq Size 1272
RefSeq ORF 851
Synonyms PSEC0222
Summary This gene encodes a membrane protein which contains a coiled-coil domain in the central region. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2013]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CCDC107 (NM_174923) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305865 CCDC107 MS Standard C13 and N15-labeled recombinant protein (NP_777583) 10 ug
$3,255.00
LC406405 CCDC107 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406405 Transient overexpression lysate of coiled-coil domain containing 107 (CCDC107) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.