CCDC107 (NM_174923) Human Mass Spec Standard

SKU
PH305865
CCDC107 MS Standard C13 and N15-labeled recombinant protein (NP_777583)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205865]
Predicted MW 30.5 kDa
Protein Sequence
Protein Sequence
>RC205865 protein sequence
Red=Cloning site Green=Tags(s)

MAGAVSLLGVVGLLLVSALSGVLGDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGSLPLGA
LYTAAVAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQTEQHLNNLMAQLDPLFERVTT
LAGAQQELLNMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISPHTEASRPLPED
FCLKEDEEEVGDSQAWEEPTNWSTETWNLATSWEVGRGLRRRCSQAVAKGPSHSLGWEGGTTAEGRLKQS
LFS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_777583
RefSeq Size 1272
RefSeq ORF 851
Synonyms PSEC0222
Locus ID 203260
UniProt ID Q8WV48
Cytogenetics 9p13.3
Summary This gene encodes a membrane protein which contains a coiled-coil domain in the central region. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2013]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CCDC107 (NM_174923) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406405 CCDC107 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406405 Transient overexpression lysate of coiled-coil domain containing 107 (CCDC107) 100 ug
$436.00
TP305865 Recombinant protein of human coiled-coil domain containing 107 (CCDC107), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.