OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC107 (NM_174923) Human Mass Spec Standard

Be the first to review this product
SKU
PH305865
CCDC107 MS Standard C13 and N15-labeled recombinant protein (NP_777583)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334806 Rabbit Polyclonal Anti-CCDC107 Antibody
100 ul
$585.00
LY406405 Transient overexpression lysate of coiled-coil domain containing 107 (CCDC107) (as WB positive control) 100 ug
$436.00

Other products for "CCDC107 or NM_174923"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205865
Predicted MW 30.5 kDa
Protein Sequence
Protein Sequence
>RC205865 protein sequence
Red=Cloning site Green=Tags(s)

MAGAVSLLGVVGLLLVSALSGVLGDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGSLPLGA
LYTAAVAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQTEQHLNNLMAQLDPLFERVTT
LAGAQQELLNMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISPHTEASRPLPED
FCLKEDEEEVGDSQAWEEPTNWSTETWNLATSWEVGRGLRRRCSQAVAKGPSHSLGWEGGTTAEGRLKQS
LFS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_777583
RefSeq Size 1272
RefSeq ORF 849
Synonyms PSEC0222
Locus ID 203260
UniProt ID Q8WV48
Cytogenetics 9p13.3
Summary This gene encodes a membrane protein which contains a coiled-coil domain in the central region. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jan 2013
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC107" proteins (3)
SKU Description Size Price
LC406405 Lyophilized CCDC107 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406405 Transient overexpression lysate of coiled-coil domain containing 107 (CCDC107) (as WB positive control) 100 ug
$436.00
TP305865 Recombinant protein of human coiled-coil domain containing 107 (CCDC107), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products