UBE2W (NM_018299) Human Recombinant Protein
CAT#: TP304985
Recombinant protein of human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204985 protein sequence
Red=Cloning site Green=Tags(s) MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ VMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPK KTKWWYHDDTC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060769 |
Locus ID | 55284 |
UniProt ID | Q96B02 |
Cytogenetics | 8q21.11 |
Refseq Size | 8426 |
Refseq ORF | 453 |
Synonyms | UBC-16; UBC16 |
Summary | This gene encodes a nuclear-localized ubiquitin-conjugating enzyme (E2) that, along with ubiquitin-activating (E1) and ligating (E3) enzymes, coordinates the addition of a ubiquitin moiety to existing proteins. The encoded protein promotes the ubiquitination of Fanconi anemia complementation group proteins and may be important in the repair of DNA damage. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Protein Families | Transcription Factors |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402664 | UBE2W HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424359 | UBE2W HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402664 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2 |
USD 436.00 |
|
LY424359 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 1 |
USD 436.00 |
|
PH304985 | UBE2W MS Standard C13 and N15-labeled recombinant protein (NP_060769) |
USD 3,255.00 |
|
PH321130 | UBE2W MS Standard C13 and N15-labeled recombinant protein (NP_001001481) |
USD 3,255.00 |
|
TP321130 | Recombinant protein of human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review