UBE2W (NM_018299) Human Recombinant Protein

CAT#: TP304985

Recombinant protein of human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified UBE2W protein (Cat# TP304985). The protein was produced from HEK293T cells transfected with UBE2W cDNA clone (Cat# RC204985) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204985 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ
  VMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPK
  KTKWWYHDDTC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060769
• Locus ID: 55284
• UniProt ID: Q96B02
• Cytogenetics: 8q21.11
• Refseq Size: 8426
• Refseq ORF: 453
• Synonyms: UBC-16; UBC16
• Summary: This gene encodes a nuclear-localized ubiquitin-conjugating enzyme (E2) that, along with ubiquitin-activating (E1) and ligating (E3) enzymes, coordinates the addition of a ubiquitin moiety to existing proteins. The encoded protein promotes the ubiquitination of Fanconi anemia complementation group proteins and may be important in the repair of DNA damage. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
• Protein Families: Transcription Factors
• Protein Pathways: Ubiquitin mediated proteolysis