OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBE2W (NM_018299) Human Mass Spec Standard

Be the first to review this product
SKU
PH304985
UBE2W MS Standard C13 and N15-labeled recombinant protein (NP_060769)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY402664 Transient overexpression lysate of ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "UBE2W or NM_018299"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204985
Predicted MW 17.3 kDa
Protein Sequence
Protein Sequence
>RC204985 protein sequence
Red=Cloning site Green=Tags(s)

MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ
VMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPK
KTKWWYHDDTC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060769
RefSeq Size 8426
RefSeq ORF 453
Synonyms UBC-16; UBC16
Locus ID 55284
UniProt ID Q96B02
Cytogenetics 8q21.11
Summary This gene encodes a nuclear-localized ubiquitin-conjugating enzyme (E2) that, along with ubiquitin-activating (E1) and ligating (E3) enzymes, coordinates the addition of a ubiquitin moiety to existing proteins. The encoded protein promotes the ubiquitination of Fanconi anemia complementation group proteins and may be important in the repair of DNA damage. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2012
Protein Families Transcription Factors
Protein Pathways Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBE2W" proteins (7)
SKU Description Size Price
PH321130 UBE2W MS Standard C13 and N15-labeled recombinant protein (NP_001001481) 10 ug
$3,360.00
LC402664 Lyophilized UBE2W HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424359 Lyophilized UBE2W HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402664 Transient overexpression lysate of ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424359 Transient overexpression lysate of ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP304985 Recombinant protein of human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2, 20 µg 20 ug
$867.00
TP321130 Recombinant protein of human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products