OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MRGPRF (NM_145015) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP304556
Recombinant protein of human MAS-related GPR, member F (MRGPRF), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA340640 Rabbit Polyclonal Anti-MRGPRF Antibody (C-Terminus)
50 ug
$550.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MRGPRF or NM_145015"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204556 protein sequence
Red=Cloning site Green=Tags(s)

MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFG
FSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAE
RCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCC
PLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCI
CINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_659452
Locus ID 116535
UniProt ID Q96AM1
Cytogenetics 11q13.3
RefSeq Size 2308
RefSeq ORF 1029
Synonyms GPR140; GPR168; MRGF; RTA
Summary Orphan receptor. May bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories GPCR, Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MRGPRF" proteins (5)
SKU Description Size Price
PH304556 MRGPRF MS Standard C13 and N15-labeled recombinant protein (NP_659452) 10 ug
$3,360.00
LC403413 Lyophilized MRGPRF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420613 Lyophilized MRGPRF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403413 Transient overexpression lysate of MAS-related GPR, member F (MRGPRF), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420613 Transient overexpression lysate of MAS-related GPR, member F (MRGPRF), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products