MRGPRF (NM_145015) Human Mass Spec Standard

SKU
PH304556
MRGPRF MS Standard C13 and N15-labeled recombinant protein (NP_659452)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204556]
Predicted MW 38.2 kDa
Protein Sequence
Protein Sequence
>RC204556 protein sequence
Red=Cloning site Green=Tags(s)

MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFG
FSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAE
RCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCC
PLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCI
CINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_659452
RefSeq Size 2308
RefSeq ORF 1029
Synonyms GPR140; GPR168; MRGF; RTA
Locus ID 116535
UniProt ID Q96AM1
Cytogenetics 11q13.3
Summary Orphan receptor. May bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MRGPRF (NM_145015) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403413 MRGPRF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420613 MRGPRF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426018 MRGPRF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403413 Transient overexpression lysate of MAS-related GPR, member F (MRGPRF), transcript variant 2 100 ug
$436.00
LY420613 Transient overexpression lysate of MAS-related GPR, member F (MRGPRF), transcript variant 1 100 ug
$436.00
TP304556 Recombinant protein of human MAS-related GPR, member F (MRGPRF), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.