OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TAGLN3 (NM_013259) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP304424
Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA366407 TAGLN3 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TAGLN3 or NM_013259"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204424 protein sequence
Red=Cloning site Green=Tags(s)

MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLY
PPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKD
DGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_037391
Locus ID 29114
UniProt ID Q9UI15
Cytogenetics 3q13.2
RefSeq Size 1503
RefSeq ORF 597
Synonyms NP22; NP24; NP25
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TAGLN3" proteins (11)
SKU Description Size Price
PH304424 TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_037391) 10 ug
$3,360.00
PH316395 TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008274) 10 ug
$3,360.00
PH323474 TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008273) 10 ug
$3,360.00
LC415704 Lyophilized TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423411 Lyophilized TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423412 Lyophilized TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415704 Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423411 Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY423412 Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP316395 Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 3, 20 µg 20 ug
$737.00
TP323474 Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products