TAGLN3 (NM_001008273) Human Recombinant Protein

SKU
TP316395
Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216395 protein sequence
Red=Cloning site Green=Tags(s)

MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLY
PPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKD
DGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001008274
Locus ID 29114
UniProt ID Q9UI15
Cytogenetics 3q13.2
RefSeq Size 1214
RefSeq ORF 597
Synonyms NP22; NP24; NP25
Write Your Own Review
You're reviewing:TAGLN3 (NM_001008273) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304424 TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_037391) 10 ug
$3,255.00
PH316395 TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008274) 10 ug
$3,255.00
PH323474 TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008273) 10 ug
$3,255.00
LC415704 TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423411 TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423412 TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415704 Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 1 100 ug
$436.00
LY423411 Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 2 100 ug
$436.00
LY423412 Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 3 100 ug
$436.00
TP304424 Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 1, 20 µg 20 ug
$737.00
TP323474 Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.