TAGLN3 (NM_001008272) Human Mass Spec Standard

SKU
PH323474
TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008273)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223474]
Predicted MW 22.5 kDa
Protein Sequence
Protein Sequence
>RC223474 protein sequence
Red=Cloning site Green=Tags(s)

MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLY
PPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKD
DGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001008273
RefSeq Size 1329
RefSeq ORF 597
Synonyms NP22; NP24; NP25
Locus ID 29114
UniProt ID Q9UI15
Cytogenetics 3q13.2
Write Your Own Review
You're reviewing:TAGLN3 (NM_001008272) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304424 TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_037391) 10 ug
$3,255.00
PH316395 TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008274) 10 ug
$3,255.00
LC415704 TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423411 TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423412 TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415704 Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 1 100 ug
$436.00
LY423411 Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 2 100 ug
$436.00
LY423412 Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 3 100 ug
$436.00
TP304424 Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 1, 20 µg 20 ug
$737.00
TP316395 Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 3, 20 µg 20 ug
$737.00
TP323474 Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.