OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ERGIC3 (NM_015966) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP304084
Recombinant protein of human ERGIC and golgi 3 (ERGIC3), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA365816 ERGIC3 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ERGIC3 or NM_015966"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204084 protein sequence
Red=Cloning site Green=Tags(s)

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKI
NIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPD
RCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKV
AGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFV
KVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCA
IIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 43 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057050
Locus ID 51614
UniProt ID Q9Y282
Cytogenetics 20q11.22
RefSeq Size 1368
RefSeq ORF 1149
Synonyms C2orf47; C20orf47; CGI-54; dJ477O4.2; Erv46; NY-BR-84; PRO0989; SDBCAG84
Summary Possible role in transport between endoplasmic reticulum and Golgi.UniProtKB/Swiss-Prot Function
Protein Categories Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ERGIC3" proteins (7)
SKU Description Size Price
PH304084 ERGIC3 MS Standard C13 and N15-labeled recombinant protein (NP_057050) 10 ug
$3,360.00
PH322204 ERGIC3 MS Standard C13 and N15-labeled recombinant protein (NP_938408) 10 ug
$3,360.00
LC402478 Lyophilized ERGIC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405049 Lyophilized ERGIC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402478 Transient overexpression lysate of ERGIC and golgi 3 (ERGIC3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY405049 Transient overexpression lysate of ERGIC and golgi 3 (ERGIC3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP322204 Recombinant protein of human ERGIC and golgi 3 (ERGIC3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products