ERGIC3 (NM_015966) Human Mass Spec Standard

SKU
PH304084
ERGIC3 MS Standard C13 and N15-labeled recombinant protein (NP_057050)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204084]
Predicted MW 43.2 kDa
Protein Sequence
Protein Sequence
>RC204084 protein sequence
Red=Cloning site Green=Tags(s)

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKI
NIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPD
RCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKV
AGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFV
KVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCA
IIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057050
RefSeq Size 1368
RefSeq ORF 1149
Synonyms C2orf47; C20orf47; CGI-54; dJ477O4.2; Erv46; NY-BR-84; PRO0989; SDBCAG84
Locus ID 51614
UniProt ID Q9Y282
Cytogenetics 20q11.22
Summary Possible role in transport between endoplasmic reticulum and Golgi.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ERGIC3 (NM_015966) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH322204 ERGIC3 MS Standard C13 and N15-labeled recombinant protein (NP_938408) 10 ug
$3,255.00
LC402478 ERGIC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405049 ERGIC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402478 Transient overexpression lysate of ERGIC and golgi 3 (ERGIC3), transcript variant 2 100 ug
$436.00
LY405049 Transient overexpression lysate of ERGIC and golgi 3 (ERGIC3), transcript variant 1 100 ug
$436.00
TP304084 Recombinant protein of human ERGIC and golgi 3 (ERGIC3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322204 Recombinant protein of human ERGIC and golgi 3 (ERGIC3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.