SAT2 (NM_133491) Human Recombinant Protein

CAT#: TP304044

Reviews ()
Write a review

Recombinant protein of human spermidine/spermine N1-acetyltransferase family member 2 (SAT2)



USD 823.00


Availability*
In Stock

Size
    • 20 ug


Product images

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC204044 protein sequence
Red=Cloning site Green=Tags(s)

MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPC
VVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLY
KALGAQDLTEAEGWHFFCFQGEATRKLAGK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 19 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_597998
Locus ID 112483
UniProt ID Q96F10
Cytogenetics 17p13.1
Refseq Size 983
Refseq ORF 510
Synonyms SSAT2
Summary Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine > spermidine = spermine >> N(1)acetylspermine = putrescine.[UniProtKB/Swiss-Prot Function]
Protein Pathways Arginine and proline metabolism, Metabolic pathways

Documents

Other products for "SAT2"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.