OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SAT2 (NM_133491) Human Mass Spec Standard

Be the first to review this product
SKU
PH304044
SAT2 MS Standard C13 and N15-labeled recombinant protein (NP_597998)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504633 SAT2 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9) 100 ul
$447.00
LY408821 Transient overexpression lysate of spermidine/spermine N1-acetyltransferase family member 2 (SAT2) (as WB positive control) 100 ug
$436.00

Other products for "SAT2 or NM_133491"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204044
Predicted MW 19.2 kDa
Protein Sequence
Protein Sequence
>RC204044 protein sequence
Red=Cloning site Green=Tags(s)

MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPC
VVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLY
KALGAQDLTEAEGWHFFCFQGEATRKLAGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_597998
RefSeq Size 983
RefSeq ORF 510
Synonyms SSAT2
Locus ID 112483
UniProt ID Q96F10
Cytogenetics 17p13.1
Summary Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine > spermidine = spermine >> N(1)acetylspermine = putrescine.UniProtKB/Swiss-Prot Function
Protein Pathways Arginine and proline metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SAT2" proteins (3)
SKU Description Size Price
LC408821 Lyophilized SAT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408821 Transient overexpression lysate of spermidine/spermine N1-acetyltransferase family member 2 (SAT2) (as WB positive control) 100 ug
$436.00
TP304044 Recombinant protein of human spermidine/spermine N1-acetyltransferase family member 2 (SAT2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products