OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Clusterin (CLU) (NM_203339) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303941
Recombinant protein of human clusterin (CLU), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA808665 CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Clusterin or NM_203339"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203941 protein sequence
Red=Cloning site Green=Tags(s)

MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTL
LSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQL
EEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFS
LPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDD
DRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQW
KMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP
VEVSRKNPKFMETVAEKALQEYRKKHREE

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 50 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_976084
Locus ID 1191
UniProt ID P10909
Cytogenetics 8p21.1
RefSeq Size 3012
RefSeq ORF 1347
Synonyms AAG4; APOJ; CLI; KUB1; MGC24903; SGP-2; SGP2; SP-40; TRPM-2; TRPM2
Summary The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.provided by RefSeq, May 2011
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Clusterin" proteins (8)
SKU Description Size Price
PH303941 CLU MS Standard C13 and N15-labeled recombinant protein (NP_976084) 10 ug
$3,360.00
PH311875 CLU MS Standard C13 and N15-labeled recombinant protein (NP_001822) 10 ug
$3,360.00
LC404400 Lyophilized CLU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433124 Lyophilized CLU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404400 Transient overexpression lysate of clusterin (CLU), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY433124 Transient overexpression lysate of clusterin (CLU), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP311875 Recombinant protein of human clusterin (CLU), transcript variant 1, 20 µg 20 ug
$737.00
TP720381 Recombinant protein of human clusterin (CLU), transcript variant 1 10 ug
$235.00

file-alt Citations

Protective role of clusterin in preserving endothelial function in AL amyloidosis
Franco, Truran, Burciu et al
Atherosclerosis (2012) 225 (1), 220-3 DOI: 10.1016/j.atherosclerosis.2012.08.028
Cited by 20
AI Summary: OriGene's recombinant human clusterin was used in this study to test its protective effects on endothelial cells exposed to toxic light chain proteins, demonstrating that it attenuates cell death and restores vascular function in the context of AL amyloidosis.
Snippet: fragmentation ELISA (Roche, Indianapolis IN) in LC (50 g/mL)-treated EC with or without recombinant human clusterin (Origene, Rockville MD ... RK, Eastwood, D., Bowers, M., Harmann, L. and Hari, P., Left ventricular ejection time on echocardiography predicts long-term mortality
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products