OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Clusterin (CLU) (NM_203339) Human Mass Spec Standard

Be the first to review this product
SKU
PH303941
CLU MS Standard C13 and N15-labeled recombinant protein (NP_976084)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808665 CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3) 100 ul
$447.00
LY433124 Transient overexpression lysate of clusterin (CLU), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "Clusterin or NM_203339"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203941
Predicted MW 52.5 kDa
Protein Sequence
Protein Sequence
>RC203941 protein sequence
Red=Cloning site Green=Tags(s)

MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTL
LSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQL
EEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFS
LPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDD
DRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQW
KMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP
VEVSRKNPKFMETVAEKALQEYRKKHREE

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_976084
RefSeq Size 3012
RefSeq ORF 1347
Synonyms AAG4; APOJ; CLI; KUB1; MGC24903; SGP-2; SGP2; SP-40; TRPM-2; TRPM2
Locus ID 1191
UniProt ID P10909
Cytogenetics 8p21.1
Summary The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.provided by RefSeq, May 2011
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Clusterin" proteins (8)
SKU Description Size Price
PH311875 CLU MS Standard C13 and N15-labeled recombinant protein (NP_001822) 10 ug
$3,360.00
LC404400 Lyophilized CLU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433124 Lyophilized CLU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404400 Transient overexpression lysate of clusterin (CLU), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY433124 Transient overexpression lysate of clusterin (CLU), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP303941 Recombinant protein of human clusterin (CLU), transcript variant 2, 20 µg 20 ug
$737.00
TP311875 Recombinant protein of human clusterin (CLU), transcript variant 1, 20 µg 20 ug
$737.00
TP720381 Recombinant protein of human clusterin (CLU), transcript variant 1 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products