Clusterin (CLU) (NM_001831) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC211875] |
Predicted MW | 57.7 kDa |
Protein Sequence |
Protein Sequence
>RC211875 representing NM_001831
Red=Cloning site Green=Tags(s) MQVCSQPQRGCVREQSAINTAPPSAHNAASPGGARGHRVPLTEACKDSRIGGMMKTLLLFVGLLLTWESG QVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNET RESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDR IDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRS LMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRM KDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNW VSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKA LQEYRKKHREE SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001822 |
RefSeq Size | 2859 |
RefSeq ORF | 1503 |
Synonyms | AAG4; APO-J; APOJ; CLI; CLU1; CLU2; KUB1; NA1/NA2; SGP-2; SGP2; SP-40; TRPM-2; TRPM2 |
Locus ID | 1191 |
UniProt ID | P10909 |
Cytogenetics | 8p21.1 |
Summary | The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.[provided by RefSeq, May 2011] |
Protein Families | Druggable Genome, Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303941 | CLU MS Standard C13 and N15-labeled recombinant protein (NP_976084) | 10 ug |
$3,255.00
|
|
LC404400 | CLU HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC433124 | CLU HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404400 | Transient overexpression lysate of clusterin (CLU), transcript variant 2 | 100 ug |
$436.00
|
|
LY433124 | Transient overexpression lysate of clusterin (CLU), transcript variant 3 | 100 ug |
$436.00
|
|
TP303941 | Recombinant protein of human clusterin (CLU), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP311875 | Recombinant protein of human clusterin (CLU), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP720381 | Recombinant protein of human clusterin (CLU), transcript variant 1 | 10 ug |
$230.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.