Clusterin (CLU) (NM_001831) Human Mass Spec Standard

SKU
PH311875
CLU MS Standard C13 and N15-labeled recombinant protein (NP_001822)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211875]
Predicted MW 57.7 kDa
Protein Sequence
Protein Sequence
>RC211875 representing NM_001831
Red=Cloning site Green=Tags(s)

MQVCSQPQRGCVREQSAINTAPPSAHNAASPGGARGHRVPLTEACKDSRIGGMMKTLLLFVGLLLTWESG
QVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNET
RESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDR
IDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRS
LMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRM
KDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNW
VSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKA
LQEYRKKHREE

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001822
RefSeq Size 2859
RefSeq ORF 1503
Synonyms AAG4; APO-J; APOJ; CLI; CLU1; CLU2; KUB1; NA1/NA2; SGP-2; SGP2; SP-40; TRPM-2; TRPM2
Locus ID 1191
UniProt ID P10909
Cytogenetics 8p21.1
Summary The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.[provided by RefSeq, May 2011]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:Clusterin (CLU) (NM_001831) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303941 CLU MS Standard C13 and N15-labeled recombinant protein (NP_976084) 10 ug
$3,255.00
LC404400 CLU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433124 CLU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404400 Transient overexpression lysate of clusterin (CLU), transcript variant 2 100 ug
$436.00
LY433124 Transient overexpression lysate of clusterin (CLU), transcript variant 3 100 ug
$436.00
TP303941 Recombinant protein of human clusterin (CLU), transcript variant 2, 20 µg 20 ug
$737.00
TP311875 Recombinant protein of human clusterin (CLU), transcript variant 1, 20 µg 20 ug
$737.00
TP720381 Recombinant protein of human clusterin (CLU), transcript variant 1 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.