ROC2 (RNF7) (NM_014245) Human Recombinant Protein

CAT#: TP303831

Recombinant protein of human ring finger protein 7 (RNF7), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified RNF7 protein (Cat# TP303831). The protein was produced from HEK293T cells transfected with RNF7 cDNA clone (Cat# RC203831) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203831 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQ
  EDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055060
• Locus ID: 9616
• UniProt ID: Q9UBF6
• Cytogenetics: 3q23
• Refseq Size: 2010
• Refseq ORF: 339
• Synonyms: CKBBP1; rbx2; ROC2; SAG
• Summary: The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII). The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis