OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFT43 (NM_052873) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303591
Recombinant protein of human chromosome 14 open reading frame 179 (C14orf179), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "IFT43 or NM_052873"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203591 protein sequence
Red=Cloning site Green=Tags(s)

MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKA
SNGTQTGKQQLDLNACYHKTHHRNLGLASLEEADIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDL
DNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQA
RHT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_443105
Locus ID 112752
UniProt ID Q96FT9
Cytogenetics 14q24.3
RefSeq Size 865
RefSeq ORF 639
Synonyms C14orf179; CED3; RP81; SRTD18
Summary This gene encodes a subunit of the intraflagellar transport complex A (IFT-A). IFT-A is a multiprotein complex that plays an important role in cilia assembly and maintenance by mediating retrograde ciliary transport. Mutations in this gene are a cause of cranioectodermal dysplasia-3 (CED3), also known as Sensenbrenner syndrome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Dec 2011
Protein Categories Cytokines, Intracellular Proteins, Nervous system Diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IFT43" proteins (5)
SKU Description Size Price
PH303591 C14orf179 MS Standard C13 and N15-labeled recombinant protein (NP_443105) 10 ug
$3,360.00
LC409416 Lyophilized IFT43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420159 Lyophilized IFT43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409416 Transient overexpression lysate of chromosome 14 open reading frame 179 (C14orf179), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420159 Transient overexpression lysate of chromosome 14 open reading frame 179 (C14orf179), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products