OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFT43 (NM_052873) Human Mass Spec Standard

Be the first to review this product
SKU
PH303591
C14orf179 MS Standard C13 and N15-labeled recombinant protein (NP_443105)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY409416 Transient overexpression lysate of chromosome 14 open reading frame 179 (C14orf179), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "IFT43 or NM_052873"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203591
Predicted MW 23.9 kDa
Protein Sequence
Protein Sequence
>RC203591 protein sequence
Red=Cloning site Green=Tags(s)

MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKA
SNGTQTGKQQLDLNACYHKTHHRNLGLASLEEADIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDL
DNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQA
RHT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443105
RefSeq Size 865
RefSeq ORF 639
Synonyms C14orf179; CED3; RP81; SRTD18
Locus ID 112752
UniProt ID Q96FT9
Cytogenetics 14q24.3
Summary This gene encodes a subunit of the intraflagellar transport complex A (IFT-A). IFT-A is a multiprotein complex that plays an important role in cilia assembly and maintenance by mediating retrograde ciliary transport. Mutations in this gene are a cause of cranioectodermal dysplasia-3 (CED3), also known as Sensenbrenner syndrome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Dec 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IFT43" proteins (5)
SKU Description Size Price
LC409416 Lyophilized IFT43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420159 Lyophilized IFT43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409416 Transient overexpression lysate of chromosome 14 open reading frame 179 (C14orf179), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420159 Transient overexpression lysate of chromosome 14 open reading frame 179 (C14orf179), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303591 Recombinant protein of human chromosome 14 open reading frame 179 (C14orf179), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products