CES2 (NM_003869) Human Recombinant Protein

SKU
TP303009
Recombinant protein of human carboxylesterase 2 (intestine, liver) (CES2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203009 protein sequence
Red=Cloning site Green=Tags(s)

MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQQRVRRQRTETSEPTMRLHRL
RARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLGIPFAKPPLGPLRFAPP
EPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNLPVMVWI
HGGALVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFG
GNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSE
ALVGCLRGKSKEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRI
YDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHF
QCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFAR
NGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHTEL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 68.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003860
Locus ID 8824
UniProt ID O00748
Cytogenetics 16q22.1
RefSeq Size 3955
RefSeq ORF 1869
Synonyms CE-2; CES2A1; iCE; PCE-2
Summary This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. The protein encoded by this gene is the major intestinal enzyme and functions in intestine drug clearance. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Oct 2010]
Protein Families Druggable Genome
Protein Pathways Drug metabolism - other enzymes
Write Your Own Review
You're reviewing:CES2 (NM_003869) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303009 CES2 MS Standard C13 and N15-labeled recombinant protein (NP_003860) 10 ug
$3,255.00
PH323021 CES2 MS Standard C13 and N15-labeled recombinant protein (NP_932327) 10 ug
$3,255.00
LC401274 CES2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405086 CES2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401274 Transient overexpression lysate of carboxylesterase 2 (intestine, liver) (CES2), transcript variant 1 100 ug
$436.00
LY405086 Transient overexpression lysate of carboxylesterase 2 (intestine, liver) (CES2), transcript variant 2 100 ug
$665.00
TP323021 Recombinant protein of human carboxylesterase 2 (intestine, liver) (CES2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.