CES2 (NM_003869) Human Mass Spec Standard

SKU
PH303009
CES2 MS Standard C13 and N15-labeled recombinant protein (NP_003860)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203009]
Predicted MW 68.9 kDa
Protein Sequence
Protein Sequence
>RC203009 protein sequence
Red=Cloning site Green=Tags(s)

MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQQRVRRQRTETSEPTMRLHRL
RARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLGIPFAKPPLGPLRFAPP
EPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNLPVMVWI
HGGALVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFG
GNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSE
ALVGCLRGKSKEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRI
YDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHF
QCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFAR
NGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHTEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003860
RefSeq Size 3955
RefSeq ORF 1869
Synonyms CE-2; CES2A1; iCE; PCE-2
Locus ID 8824
UniProt ID O00748
Cytogenetics 16q22.1
Summary This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. The protein encoded by this gene is the major intestinal enzyme and functions in intestine drug clearance. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Oct 2010]
Protein Families Druggable Genome
Protein Pathways Drug metabolism - other enzymes
Write Your Own Review
You're reviewing:CES2 (NM_003869) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH323021 CES2 MS Standard C13 and N15-labeled recombinant protein (NP_932327) 10 ug
$3,255.00
LC401274 CES2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405086 CES2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401274 Transient overexpression lysate of carboxylesterase 2 (intestine, liver) (CES2), transcript variant 1 100 ug
$436.00
LY405086 Transient overexpression lysate of carboxylesterase 2 (intestine, liver) (CES2), transcript variant 2 100 ug
$665.00
TP303009 Recombinant protein of human carboxylesterase 2 (intestine, liver) (CES2), transcript variant 1, 20 µg 20 ug
$737.00
TP323021 Recombinant protein of human carboxylesterase 2 (intestine, liver) (CES2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.