OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ROR alpha (RORA) (NM_134261) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302926
Recombinant protein of human RAR-related orphan receptor A (RORA), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA803201 RORA mouse monoclonal antibody, clone OTI2C4 (formerly 2C4) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ROR alpha or NM_134261"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202926 representing NM_134261
Red=Cloning site Green=Tags(s)

MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEI
IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSR
DAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPE
GSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNI
SKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQN
DQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMA
FKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 58.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_599023
Locus ID 6095
UniProt ID P35398
Cytogenetics 15q22.2
RefSeq Size 1847
RefSeq ORF 1569
Synonyms IDDECA; NR1F1; ROR1; ROR2; ROR3; RZR-ALPHA; RZRA
Summary The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptional regulation of some genes involved in circadian rhythm. Four transcript variants encoding different isoforms have been described for this gene. provided by RefSeq, Feb 2014
Protein Categories Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ROR alpha" proteins (7)
SKU Description Size Price
PH302926 RORA MS Standard C13 and N15-labeled recombinant protein (NP_599023) 10 ug
$3,360.00
LC401041 Lyophilized RORA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403350 Lyophilized RORA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408623 Lyophilized RORA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401041 Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY403350 Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY408623 Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 4 (as WB positive control) 100 ug
$665.00

file-alt Citations

The CH25H-CYP7B1-RORα axis of cholesterol metabolism regulates osteoarthritis
Choi, Lee, Song et al
Nature (2019) 566 (7743), 254-258 DOI: 10.1038/s41586-019-0920-1
AI Summary: OriGene’s full-length recombinant RORα protein was used in competition binding assays to determine how cholesterol and its metabolites interact with RORα, helping elucidate the role of cholesterol metabolism in osteoarthritis pathogenesis.
Snippet: Binding of cholesterol, 25-HC and 7α,25-HC to RORα were determined by competition assays performed using fluorescent 22-NBD cholesterol (Thermo Fisher Scientific), which binds to full-length recombinant RORα protein (OriGene)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products