ROR alpha (RORA) (NM_134261) Human Mass Spec Standard

SKU
PH302926
RORA MS Standard C13 and N15-labeled recombinant protein (NP_599023)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202926]
Predicted MW 58.8 kDa
Protein Sequence
Protein Sequence
>RC202926 representing NM_134261
Red=Cloning site Green=Tags(s)

MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEI
IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSR
DAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPE
GSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNI
SKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQN
DQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMA
FKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_599023
RefSeq Size 1847
RefSeq ORF 1569
Synonyms IDDECA; NR1F1; ROR1; ROR2; ROR3; RZR-ALPHA; RZRA
Locus ID 6095
UniProt ID P35398
Cytogenetics 15q22.2
Summary The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptional regulation of some genes involved in circadian rhythm. Four transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2014]
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Write Your Own Review
You're reviewing:ROR alpha (RORA) (NM_134261) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401041 RORA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403350 RORA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408623 RORA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401041 Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 3 100 ug
$665.00
LY403350 Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 1 100 ug
$436.00
LY408623 Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 4 100 ug
$665.00
TP302926 Recombinant protein of human RAR-related orphan receptor A (RORA), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.