VAMP4 (NM_003762) Human Recombinant Protein

CAT#: TP302734

Recombinant protein of human vesicle-associated membrane protein 4 (VAMP4), 20 µg

Product Images

Coomassie blue staining of purified VAMP4 protein (Cat# TP302734). The protein was produced from HEK293T cells transfected with VAMP4 cDNA clone (Cat# RC202734) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202734 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENI
  TKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003753
• Locus ID: 8674
• UniProt ID: O75379, Q6IAZ3
• Cytogenetics: 1q24.3
• Refseq Size: 5155
• Refseq ORF: 363
• Synonyms: VAMP-4; VAMP24
• Summary: Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport