OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VAMP4 (NM_003762) Human Mass Spec Standard

Be the first to review this product
SKU
PH302734
VAMP4 MS Standard C13 and N15-labeled recombinant protein (NP_003753)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350594 Rabbit Polyclonal Anti-VAMP4 Antibody
100 ul
$205.00
LY418448 Transient overexpression lysate of vesicle-associated membrane protein 4 (VAMP4) (as WB positive control) 100 ug
$436.00

Other products for "VAMP4 or NM_003762"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202734
Predicted MW 16.2 kDa
Protein Sequence
Protein Sequence
>RC202734 protein sequence
Red=Cloning site Green=Tags(s)

MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENI
TKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003753
RefSeq Size 5155
RefSeq ORF 420
Synonyms VAMP-4; VAMP24
Locus ID 8674
UniProt ID O75379
Cytogenetics 1q24.3
Summary Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport. provided by RefSeq, Jul 2008
Protein Families Transmembrane
Protein Pathways SNARE interactions in vesicular transport
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VAMP4" proteins (5)
SKU Description Size Price
LC418448 Lyophilized VAMP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433976 Lyophilized VAMP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418448 Transient overexpression lysate of vesicle-associated membrane protein 4 (VAMP4) (as WB positive control) 100 ug
$436.00
LY433976 Transient overexpression lysate of vesicle-associated membrane protein 4 (VAMP4), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302734 Recombinant protein of human vesicle-associated membrane protein 4 (VAMP4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products