OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PIN1 (NM_006221) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302543
Recombinant protein of human peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA812247 PIN1 mouse monoclonal antibody,clone OTI4H1 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PIN1 or NM_006221"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202543 protein sequence
Red=Cloning site Green=Tags(s)

MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRP
SSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFA
LRTGEMSGPVFTDSGIHIILRTE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006212
Locus ID 5300
UniProt ID Q13526
Cytogenetics 19p13.2
RefSeq Size 1138
RefSeq ORF 489
Synonyms DOD; UBL5
Summary Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.provided by RefSeq, Jun 2011
Protein Categories Cytokines, Growth Factors, Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways RIG-I-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PIN1" proteins (3)
SKU Description Size Price
PH302543 PIN1 MS Standard C13 and N15-labeled recombinant protein (NP_006212) 10 ug
$3,360.00
LC401873 Lyophilized PIN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401873 Transient overexpression lysate of peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1) (as WB positive control) 100 ug
$436.00

file-alt Citations

Analysis of binding interfaces of the human scaffold protein AXIN1 by peptide microarrays
Harnoš, Ryneš, Víšková et al
J. Biol. Chem. (2018) 293 (42), 16337-16347 DOI: 10.1074/jbc.RA118.005127
AI Summary: In this study, OriGene products CK1ε (#TP302436), p53 (#TP300003), and Pin1 (#TP302543) were used as purified proteins to investigate and validate their binding interactions with AXIN1 using peptide microarrays.
Snippet: CK1ε (OriGene Technologies' #TP302436), p53 (OriGene Technologies, #TP300003) Pin1 (OriGene Technologies #TP302543), c-Myc (Abnova, #H00004609-P01) in SmartBlock FLAG-DVL3 wt(30), CK1ϵ wt(17), Constitutive active β-catenin S33A(31), FLAG-Shp2
The Consequences of CK1ε-induced Phosphorylation of the Selected Components of the WNT/β-catenin Pathway: Structural Biology Point of View
HARNOŠ
Thesis (2018)
Snippet: Then, the experimental slide was incubated overnight with 10 μg/mL of recombinant protein: CK1ε (OriGene Technologies‚ #TP302436), p53 (OriGene Technologies, #TP300003) Pin1 (OriGene Technologies #TP302543), c-Myc (Abnova, #H00004609-P01) in SmartBlock solution (final volume 300 µl) at 4 °C. The next day, both slides were washed in 300 µl of TBS buffer (4x 10 min, RT)
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products