OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PIN1 (NM_006221) Human Mass Spec Standard

Be the first to review this product
SKU
PH302543
PIN1 MS Standard C13 and N15-labeled recombinant protein (NP_006212)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA812247 PIN1 mouse monoclonal antibody,clone OTI4H1 100 ul
$447.00
LY401873 Transient overexpression lysate of peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1) (as WB positive control) 100 ug
$436.00

Other products for "PIN1 or NM_006221"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202543
Predicted MW 18.2 kDa
Protein Sequence
Protein Sequence
>RC202543 protein sequence
Red=Cloning site Green=Tags(s)

MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRP
SSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFA
LRTGEMSGPVFTDSGIHIILRTE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006212
RefSeq Size 1138
RefSeq ORF 489
Synonyms DOD; UBL5
Locus ID 5300
UniProt ID Q13526
Cytogenetics 19p13.2
Summary Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.provided by RefSeq, Jun 2011
Protein Families Druggable Genome
Protein Pathways RIG-I-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PIN1" proteins (3)
SKU Description Size Price
LC401873 Lyophilized PIN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401873 Transient overexpression lysate of peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1) (as WB positive control) 100 ug
$436.00
TP302543 Recombinant protein of human peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products