OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

beta Synuclein (SNCB) (NM_003085) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302449
Recombinant protein of human synuclein, beta (SNCB), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA312076 Rabbit polyclonal Synuclein beta antibody
100 ul
$380.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "beta Synuclein or NM_003085"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202449 protein sequence
Red=Cloning site Green=Tags(s)

MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAV
FSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003076
Locus ID 6620
UniProt ID Q16143
Cytogenetics 5q35.2
RefSeq Size 1310
RefSeq ORF 402
Summary This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2015
Protein Categories Intracellular Proteins, Nervous system: Neurodegenerative diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "beta Synuclein" proteins (7)
SKU Description Size Price
PH302449 SNCB MS Standard C13 and N15-labeled recombinant protein (NP_003076) 10 ug
$3,360.00
PH315165 SNCB MS Standard C13 and N15-labeled recombinant protein (NP_001001502) 10 ug
$3,360.00
LC401075 Lyophilized SNCB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424365 Lyophilized SNCB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401075 Transient overexpression lysate of synuclein, beta (SNCB), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424365 Transient overexpression lysate of synuclein, beta (SNCB), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP315165 Recombinant protein of human synuclein, beta (SNCB), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products