OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

beta Synuclein (SNCB) (NM_001001502) Human Mass Spec Standard

Be the first to review this product
SKU
PH315165
SNCB MS Standard C13 and N15-labeled recombinant protein (NP_001001502)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA312076 Rabbit polyclonal Synuclein beta antibody
100 ul
$380.00
LY424365 Transient overexpression lysate of synuclein, beta (SNCB), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "beta Synuclein or NM_001001502"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215165
Predicted MW 14.3 kDa
Protein Sequence
Protein Sequence
>RC215165 protein sequence
Red=Cloning site Green=Tags(s)

MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAV
FSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001001502
RefSeq Size 1467
RefSeq ORF 402
Locus ID 6620
UniProt ID Q16143
Cytogenetics 5q35.2
Summary This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "beta Synuclein" proteins (7)
SKU Description Size Price
PH302449 SNCB MS Standard C13 and N15-labeled recombinant protein (NP_003076) 10 ug
$3,360.00
LC401075 Lyophilized SNCB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424365 Lyophilized SNCB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401075 Transient overexpression lysate of synuclein, beta (SNCB), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424365 Transient overexpression lysate of synuclein, beta (SNCB), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302449 Recombinant protein of human synuclein, beta (SNCB), transcript variant 2, 20 µg 20 ug
$867.00
TP315165 Recombinant protein of human synuclein, beta (SNCB), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products