ACY3 (NM_080658) Human Recombinant Protein

CAT#: TP302287

Recombinant protein of human aspartoacylase (aminocyclase) 3 (ACY3), 20 µg

Product Images

Coomassie blue staining of purified ACY3 protein (Cat# TP302287). The protein was produced from HEK293T cells transfected with ACY3 cDNA clone (Cat# RC202287) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202287 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLN
  RTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTANMGTCLIAKSSHEVFAMHLC
  RHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMRTLVATVLDFIELFN
  QGTAFPAFEMEAYRPVGVVDFPRTEAGHLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYP
  VFINEAAYYEKGVAFVQTEKFTFTVPAMPALTPAPSPAS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_542389
• Locus ID: 91703
• UniProt ID: Q96HD9, A0A024R5L2
• Cytogenetics: 11q13.2
• Refseq Size: 1317
• Refseq ORF: 957
• Synonyms: ACY-3; HCBP1
• Summary: Plays an important role in deacetylating mercapturic acids in kidney proximal tubules. Also acts on N-acetyl-aromatic amino acids (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Alanine, aspartate and glutamate metabolism, Histidine metabolism