OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ACY3 (NM_080658) Human Mass Spec Standard

Be the first to review this product
SKU
PH302287
ACY3 MS Standard C13 and N15-labeled recombinant protein (NP_542389)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502295 ACY3 mouse monoclonal antibody, clone OTI2D5 (formerly 2D5) 100 ul
$447.00
LY408962 Transient overexpression lysate of aspartoacylase (aminocyclase) 3 (ACY3) (as WB positive control) 100 ug
$436.00

Other products for "ACY3 or NM_080658"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202287
Predicted MW 35.2 kDa
Protein Sequence
Protein Sequence
>RC202287 protein sequence
Red=Cloning site Green=Tags(s)

MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLN
RTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTANMGTCLIAKSSHEVFAMHLC
RHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMRTLVATVLDFIELFN
QGTAFPAFEMEAYRPVGVVDFPRTEAGHLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYP
VFINEAAYYEKGVAFVQTEKFTFTVPAMPALTPAPSPAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542389
RefSeq Size 1317
RefSeq ORF 957
Synonyms ACY-3; HCBP1
Locus ID 91703
UniProt ID Q96HD9
Cytogenetics 11q13.2
Summary Plays an important role in deacetylating mercapturic acids in kidney proximal tubules. Also acts on N-acetyl-aromatic amino acids (By similarity).UniProtKB/Swiss-Prot Function
Protein Pathways Alanine, aspartate and glutamate metabolism, Histidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ACY3" proteins (3)
SKU Description Size Price
LC408962 Lyophilized ACY3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408962 Transient overexpression lysate of aspartoacylase (aminocyclase) 3 (ACY3) (as WB positive control) 100 ug
$436.00
TP302287 Recombinant protein of human aspartoacylase (aminocyclase) 3 (ACY3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products