ACY3 (NM_080658) Human Mass Spec Standard

SKU
PH302287
ACY3 MS Standard C13 and N15-labeled recombinant protein (NP_542389)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202287]
Predicted MW 35.2 kDa
Protein Sequence
Protein Sequence
>RC202287 protein sequence
Red=Cloning site Green=Tags(s)

MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLN
RTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTANMGTCLIAKSSHEVFAMHLC
RHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMRTLVATVLDFIELFN
QGTAFPAFEMEAYRPVGVVDFPRTEAGHLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYP
VFINEAAYYEKGVAFVQTEKFTFTVPAMPALTPAPSPAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542389
RefSeq Size 1317
RefSeq ORF 957
Synonyms ACY-3; HCBP1
Locus ID 91703
UniProt ID Q96HD9
Cytogenetics 11q13.2
Summary Plays an important role in deacetylating mercapturic acids in kidney proximal tubules. Also acts on N-acetyl-aromatic amino acids (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Pathways Alanine, aspartate and glutamate metabolism, Histidine metabolism
Write Your Own Review
You're reviewing:ACY3 (NM_080658) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408962 ACY3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408962 Transient overexpression lysate of aspartoacylase (aminocyclase) 3 (ACY3) 100 ug
$436.00
TP302287 Recombinant protein of human aspartoacylase (aminocyclase) 3 (ACY3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.