MYCBP (NM_012333) Human Recombinant Protein

CAT#: TP302238

Recombinant protein of human c-myc binding protein (MYCBP), 20 µg

Product Images

Coomassie blue staining of purified MYCBP protein (Cat# TP302238). The protein was produced from HEK293T cells transfected with MYCBP cDNA clone (Cat# RC202238) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202238 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELA
  EMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036465
• Locus ID: 26292
• UniProt ID: Q99417
• Cytogenetics: 1p34.3
• Refseq Size: 2583
• Refseq ORF: 309
• Synonyms: AMY-1
• Summary: The protein encoded by this gene binds to the N-terminus of the oncogenic protein C-MYC, enhancing the ability of C-MYC to activate E box-dependent transcription. The encoded protein is normally found in the cytoplasm, but it translocates to the nucleus during S phase of the cell cycle and associates with C-MYC. This protein may be involved in spermatogenesis. This gene can be silenced by microRNA-22. Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene. [provided by RefSeq, Nov 2011]
• Protein Families: ES Cell Differentiation/IPS, Transcription Factors