MYCBP (NM_012333) Human Mass Spec Standard

SKU PH302238

MYCBP MS Standard C13 and N15-labeled recombinant protein (NP_036465)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202238]
• Predicted MW: 12 kDa
• Protein Sequence:
  Protein Sequence

  >RC202238 protein sequence; Red=Cloning site Green=Tags(s); ; MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELA; EMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_036465
• RefSeq Size: 2583
• RefSeq ORF: 309
• Synonyms: AMY-1
• Locus ID: 26292
• UniProt ID: Q99417
• Cytogenetics: 1p34.3
• Summary: The protein encoded by this gene binds to the N-terminus of the oncogenic protein C-MYC, enhancing the ability of C-MYC to activate E box-dependent transcription. The encoded protein is normally found in the cytoplasm, but it translocates to the nucleus during S phase of the cell cycle and associates with C-MYC. This protein may be involved in spermatogenesis. This gene can be silenced by microRNA-22. Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene. [provided by RefSeq, Nov 2011]
• Protein Families: ES Cell Differentiation/IPS, Transcription Factors