MYCBP (NM_012333) Human Tagged ORF Clone

SKU
RC202238
MYCBP (Myc-DDK-tagged)-Human c-myc binding protein (MycBP), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MYCBP
Synonyms AMY-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202238 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCATTACAAAGCCGCCGACTCGAAGCGTGAGCAGTTCCGGAGGTACTTGGAGAAGTCGGGGGTGC
TGGACACGCTGACCAAGGTGTTGGTAGCCTTATATGAAGAACCAGAGAAACCTAACAGTGCTTTGGATTT
TTTAAAGCATCACTTAGGAGCTGCTACTCCAGAAAATCCAGAAATAGAGCTGCTTCGCCTAGAACTGGCC
GAAATGAAAGAGAAGTATGAAGCTATTGTAGAAGAAAATAAAAAACTGAAAGCAAAGCTTGCTCAGTATG
AACCACCTCAGGAGGAGAAGCGTGCTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202238 protein sequence
Red=Cloning site Green=Tags(s)

MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELA
EMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012333
ORF Size 309 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012333.5
RefSeq Size 2583 bp
RefSeq ORF 312 bp
Locus ID 26292
UniProt ID Q99417
Cytogenetics 1p34.3
Protein Families ES Cell Differentiation/IPS, Transcription Factors
MW 12 kDa
Summary The protein encoded by this gene binds to the N-terminus of the oncogenic protein C-MYC, enhancing the ability of C-MYC to activate E box-dependent transcription. The encoded protein is normally found in the cytoplasm, but it translocates to the nucleus during S phase of the cell cycle and associates with C-MYC. This protein may be involved in spermatogenesis. This gene can be silenced by microRNA-22. Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene. [provided by RefSeq, Nov 2011]
Write Your Own Review
You're reviewing:MYCBP (NM_012333) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202238L1 Lenti ORF clone of Human c-myc binding protein (MYCBP), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202238L2 Lenti ORF clone of Human c-myc binding protein (MYCBP), transcript variant 1, mGFP tagged 10 ug
$450.00
RC202238L3 Lenti ORF clone of Human c-myc binding protein (MYCBP), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202238L4 Lenti ORF clone of Human c-myc binding protein (MYCBP), transcript variant 1, mGFP tagged 10 ug
$450.00
RG202238 MYCBP (tGFP-tagged) - Human c-myc binding protein (MYCBP), transcript variant 1 10 ug
$350.00
SC107923 MYCBP (untagged)-Human c-myc binding protein (MYCBP), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.