RAB24 (NM_130781) Human Recombinant Protein

CAT#: TP302197

Recombinant protein of human RAB24, member RAS oncogene family (RAB24), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified RAB24 protein (Cat# TP302197). The protein was produced from HEK293T cells transfected with RAB24 cDNA clone (Cat# RC202197) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202197 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERY
  EAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQ
  DYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_570137
• Locus ID: 53917
• UniProt ID: Q969Q5
• Cytogenetics: 5q35.3
• Refseq Size: 1546
• Refseq ORF: 609
• Summary: RAB24 is a small GTPase of the Rab subfamily of Ras-related proteins that regulate intracellular protein trafficking (Olkkonen et al., 1993 [PubMed 8126105]).[supplied by OMIM, Aug 2009]
• Protein Families: Druggable Genome