OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB24 (NM_001031677) Human Mass Spec Standard

Be the first to review this product
SKU
PH305647
RAB24 MS Standard C13 and N15-labeled recombinant protein (NP_001026847)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505690 RAB24 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1) 100 ul
$447.00
LY408940 Transient overexpression lysate of RAB24, member RAS oncogene family (RAB24), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "RAB24 or NM_001031677"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205647
Predicted MW 23.1 kDa
Protein Sequence
Protein Sequence
>RC205647 protein sequence
Red=Cloning site Green=Tags(s)

MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERY
EAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQ
DYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001026847
RefSeq Size 1632
RefSeq ORF 609
Locus ID 53917
UniProt ID Q969Q5
Cytogenetics 5q35.3
Summary RAB24 is a small GTPase of the Rab subfamily of Ras-related proteins that regulate intracellular protein trafficking (Olkkonen et al., 1993 PubMed 8126105).supplied by OMIM, Aug 2009
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB24" proteins (7)
SKU Description Size Price
PH302197 RAB24 MS Standard C13 and N15-labeled recombinant protein (NP_570137) 10 ug
$3,360.00
LC408940 Lyophilized RAB24 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422221 Lyophilized RAB24 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408940 Transient overexpression lysate of RAB24, member RAS oncogene family (RAB24), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422221 Transient overexpression lysate of RAB24, member RAS oncogene family (RAB24), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302197 Recombinant protein of human RAB24, member RAS oncogene family (RAB24), transcript variant 2, 20 µg 20 ug
$867.00
TP305647 Recombinant protein of human RAB24, member RAS oncogene family (RAB24), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products