OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IL6 (NM_000600) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302078
Recombinant protein of human interleukin 6 (interferon, beta 2) (IL6), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA500067 IL6 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "IL6 or NM_000600"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202078 protein sequence
Red=Cloning site Green=Tags(s)

MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKE
TCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQA
RAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALR
QM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000591
Locus ID 3569
UniProt ID P05231
Cytogenetics 7p15.3
RefSeq Size 1201
RefSeq ORF 636
Synonyms BSF-2; BSF2; CDF; HGF; HSF; IFN-beta-2; IFNB2; IL-6
Summary This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2). provided by RefSeq, Aug 2020
Protein Categories Allergies and autoimmune diseases, Chemokines, Cytokines, Growth Factors, Intracellular Proteins, Membrane Proteins, Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Graft-versus-host disease, Hematopoietic cell lineage, Hypertrophic cardiomyopathy (HCM), Jak-STAT signaling pathway, NOD-like receptor signaling pathway, Pathways in cancer, Prion diseases, Toll-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IL6" proteins (8)
SKU Description Size Price
PH302078 IL6 MS Standard C13 and N15-labeled recombinant protein (NP_000591) 10 ug
$3,360.00
LC424617 Lyophilized IL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424617 Transient overexpression lysate of interleukin 6 (interferon, beta 2) (IL6) (as WB positive control) 100 ug
$436.00
TP701114 Purified recombinant protein of Human interleukin 6 (interferon, beta 2) (IL6), Val30-End, tag free, secretory expressed in HEK293 cells, 50ug 50 ug
$900.00
TP720008 Recombinant protein of human interleukin 6 (interferon, beta 2) (IL6), the mature form (Pro29-Met212) with C-terminal His tag 10 ug
$290.00
TP723713 Purified recombinant protein of Human interleukin 6 (interferon, beta 2) (IL6) 10 ug
$345.00
TP723955 Recombinant human IL6 protein with C-terminal mouse Fc and 6×His tag 100 ug
$905.00
TP750006 Recombinant protein of human Interleukin 6(IL-6) produced in E. coli. 50 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products