BMX (NM_203281) Human Recombinant Protein

SKU
TP302002
Recombinant protein of human BMX non-receptor tyrosine kinase (BMX), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202002 protein sequence
Red=Cloning site Green=Tags(s)

MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKIRCVEKVNLEE
QTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKYHSGFFVDGKFLCCQQSCKAA
PGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSS
TSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP
ESSSSEEEENLDDYDWFAGNISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYH
VHTNAENKLYLAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL
KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTE
YISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRY
VLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHR
LYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLREKDKH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 77.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_975010
Locus ID 660
UniProt ID P51813
Cytogenetics Xp22.2
RefSeq Size 2592
RefSeq ORF 2025
Synonyms ETK; PSCTK2; PSCTK3
Summary This gene encodes a non-receptor tyrosine kinase belonging to the Tec kinase family. The protein contains a PH-like domain, which mediates membrane targeting by binding to phosphatidylinositol 3,4,5-triphosphate (PIP3), and a SH2 domain that binds to tyrosine-phosphorylated proteins and functions in signal transduction. The protein is implicated in several signal transduction pathways including the Stat pathway, and regulates differentiation and tumorigenicity of several types of cancer cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2016]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:BMX (NM_203281) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302002 BMX MS Standard C13 and N15-labeled recombinant protein (NP_975010) 10 ug
$3,255.00
PH321915 BMX MS Standard C13 and N15-labeled recombinant protein (NP_001712) 10 ug
$3,255.00
LC400648 BMX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404365 BMX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400648 Transient overexpression lysate of BMX non-receptor tyrosine kinase (BMX), transcript variant 2 100 ug
$436.00
LY404365 Transient overexpression lysate of BMX non-receptor tyrosine kinase (BMX), transcript variant 1 100 ug
$436.00
TP321915 Recombinant protein of human BMX non-receptor tyrosine kinase (BMX), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.