PGRMC1 (NM_006667) Human Recombinant Protein
CAT#: TP301918
Recombinant protein of human progesterone receptor membrane component 1 (PGRMC1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201918 protein sequence
Red=Cloning site Green=Tags(s) MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKR RDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD DLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006658 |
Locus ID | 10857 |
UniProt ID | O00264, Q6IB11 |
Cytogenetics | Xq24 |
Refseq Size | 1931 |
Refseq ORF | 585 |
Synonyms | Dap1; HPR6.6; IZA; MPR |
Summary | This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401994 | PGRMC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401994 | Transient overexpression lysate of progesterone receptor membrane component 1 (PGRMC1) |
USD 436.00 |
|
PH301918 | PGRMC1 MS Standard C13 and N15-labeled recombinant protein (NP_006658) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review