PGRMC1 (NM_006667) Human Mass Spec Standard

SKU
PH301918
PGRMC1 MS Standard C13 and N15-labeled recombinant protein (NP_006658)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201918]
Predicted MW 21.7 kDa
Protein Sequence
Protein Sequence
>RC201918 protein sequence
Red=Cloning site Green=Tags(s)

MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKR
RDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD
DLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006658
RefSeq Size 1931
RefSeq ORF 585
Synonyms Dap1; HPR6.6; IZA; MPR
Locus ID 10857
UniProt ID O00264
Cytogenetics Xq24
Summary This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq, Mar 2010]
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transmembrane
Write Your Own Review
You're reviewing:PGRMC1 (NM_006667) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401994 PGRMC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401994 Transient overexpression lysate of progesterone receptor membrane component 1 (PGRMC1) 100 ug
$436.00
TP301918 Recombinant protein of human progesterone receptor membrane component 1 (PGRMC1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.