SAE1 (NM_005500) Human Recombinant Protein

SKU
TP301820
Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201820 protein sequence
Red=Cloning site Green=Tags(s)

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ
VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV
KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK
VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSL
GISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38.3 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity ELISA capture for autoantibodies (PMID: 28298642)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005491
Locus ID 10055
UniProt ID Q9UBE0
Cytogenetics 19q13.32
RefSeq Size 2538
RefSeq ORF 1038
Synonyms AOS1; HSPC140; SUA1; UBLE1A
Summary Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).[supplied by OMIM, Mar 2010]
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:SAE1 (NM_005500) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301820 SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_005491) 10 ug
$3,255.00
PH326908 SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_001139185) 10 ug
$3,255.00
PH327950 SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_057486) 10 ug
$3,255.00
LC401688 SAE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428977 SAE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429497 SAE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401688 Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 100 ug
$436.00
LY428977 Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2 100 ug
$436.00
LY429497 Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 100 ug
$436.00
TP326908 Purified recombinant protein of Homo sapiens SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327950 Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.