SAE1 (NM_005500) Human Mass Spec Standard

SKU
PH301820
SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_005491)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201820]
Predicted MW 38.4 kDa
Protein Sequence
Protein Sequence
>RC201820 protein sequence
Red=Cloning site Green=Tags(s)

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ
VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV
KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK
VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSL
GISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005491
RefSeq Size 2538
RefSeq ORF 1038
Synonyms AOS1; HSPC140; SUA1; UBLE1A
Locus ID 10055
UniProt ID Q9UBE0
Cytogenetics 19q13.32
Summary Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).[supplied by OMIM, Mar 2010]
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:SAE1 (NM_005500) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH326908 SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_001139185) 10 ug
$3,255.00
PH327950 SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_057486) 10 ug
$3,255.00
LC401688 SAE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428977 SAE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429497 SAE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401688 Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 100 ug
$436.00
LY428977 Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2 100 ug
$436.00
LY429497 Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 100 ug
$436.00
TP301820 Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326908 Purified recombinant protein of Homo sapiens SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327950 Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.