SAE1 (NM_001145713) Human Mass Spec Standard

SKU
PH326908
SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_001139185)
  $3,360.00
3 Weeks*
Bulk/Customize
Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC226908
Predicted MW 32.9 kDa
Protein Sequence
Protein Sequence
>RC226908 representing NM_001145713
Red=Cloning site Green=Tags(s)

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ
VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV
KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK
VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQGPVSAGPSSQQLLLLRWHEGEWDCGVPWPQVNSRFG
SPRDANCSMPTCIPCPLPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001139185
RefSeq ORF 897
Synonyms AOS1; HSPC140; SUA1; UBLE1A
Locus ID 10055
UniProt ID Q9UBE0
Cytogenetics 19q13.32
Summary Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 PubMed 9920803).supplied by OMIM, Mar 2010
Protein Pathways Ubiquitin mediated proteolysis
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "SAE1" proteins (11)
SKU Description Size Price
PH301820 SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_005491) 10 ug
$3,360.00
PH327950 SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_057486) 10 ug
$3,360.00
LC401688 Lyophilized SAE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428977 Lyophilized SAE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429497 Lyophilized SAE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401688 Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428977 Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY429497 Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301820 Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, 20 µg 20 ug
$867.00
TP326908 Purified recombinant protein of Homo sapiens SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2, 20 µg 20 ug
$867.00
TP327950 Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products