OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

c-Myc (MYC) (NM_002467) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301611
Recombinant protein of human v-myc myelocytomatosis viral oncogene homolog (avian) (MYC), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA500002 c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "c-Myc or NM_002467"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201611 representing NM_002467
Red=Cloning site Green=Tags(s)

LDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFEL
LPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFI
KNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVF
PYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVV
SVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQ
ISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity ELISA binding assay (PMID: 25875098)
EMSA assay (PMID: 25892221)
ELISA capture for autoantibodies (PMID: 28191285)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002458
Locus ID 4609
UniProt ID P01106
Cytogenetics 8q24.21
RefSeq Size 2379
RefSeq ORF 1362
Synonyms bHLHe39; c-Myc; MRTL; MYCC
Summary This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini. provided by RefSeq, Aug 2017
Protein Categories Cancer: Brain and CNS, Cancer: Gastrointestinal, Cancer: Gynecologic, Cancer: Haematopoietic and Lymphoid, Cancer: Head and Neck, Cancer: Lung, Cancer: Sarcoma, Cancer: Skin, Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Stem cell relevant signaling - TGFb/BMP signaling pathway, Stem cell relevant signaling - Wnt Signaling pathway, Transcription Factors
Protein Pathways Acute myeloid leukemia, Bladder cancer, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Jak-STAT signaling pathway, MAPK signaling pathway, Pathways in cancer, Small cell lung cancer, TGF-beta signaling pathway, Thyroid cancer, Wnt signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "c-Myc" proteins (6)
SKU Description Size Price
PH301611 MYC MS Standard C13 and N15-labeled recombinant protein (NP_002458) 10 ug
$3,360.00
LC400876 Lyophilized MYC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400876 Transient overexpression lysate of v-myc myelocytomatosis viral oncogene homolog (avian) (MYC) (as WB positive control) 100 ug
$436.00
TP760019 Recombinant protein of human v-myc myelocytomatosis viral oncogene homolog (avian) (MYC), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00
TP762403 Purified recombinant protein of Human v-myc myelocytomatosis viral oncogene homolog (avian) (Myc), Leu1-Asp343, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00
TP762404 Purified recombinant protein of Human v-myc myelocytomatosis viral oncogene homolog (avian) (Myc), His316-END, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00

file-alt Citations

Structural Constraints of Nucleosomes on Transcription-Factor Binding
Wilson
Thesis (2026)
AI Summary: OriGene products contributed full-length human transcription factors KLF4 (TP306691), OCT4 (TP311998), SOX2 (TP300757), and MYC (TP301611) for protein-nucleosome binding assays in the study.
Snippet: The protein-nucleosome binding assays were carried out by incubating the purified nucleosome libraries described above and human full-length KLF4 (Origene TP306691), OCT4 (Origene TP311998), SOX2 (Origene TP300757), and MYC (Origene TP301611) with MAX
Defining transcription factor nucleosome binding with Pioneer-seq
Tsompana, Wilson, Murugaiyan et al
PLoS Genet (2025) 21 (8), e1011813 DOI: 10.1371/journal.pgen.1011813
Cited by 6
Snippet: or up to 1 month. DNA binding assay followed by EMSA The protein-nucleosome binding assays were carried out by incubating the purified nucleosome libraries described above and human full-length KLF4 (Origene TP306691), OCT4 (Origene TP311998), SOX2 (Origene TP300757), and MYC (Origene TP301611) with MAX (Origene TP306812) (in 7 µl DNA binding buffer (10 mM Tris-Cl [pH7.5], 50 mM NaCl, 1 mM
FigureFigureFigure
WASp modulates RPA function on single-stranded DNA in response to replication stress and DNA damage
Han, Wen, García-Rubio et al
Nat Commun (2022) 13 (1), 3743 DOI: 10.1038/s41467-022-31415-z
Cited by 37
AI Summary: OriGene products, specifically RPA1 (TP302066), RPA2 (TP305715), MAX (TP320343), ARP3 (TP308460), FANCA (TP761743), XRCC2 (TP308330), DNMT1 (TP326414), MYC (TP301611), NF-κB1 (TP308384), and STAT1 (TP313858), were used as key reagents to investigate the molecular mechanisms by which WASp modulates RPA function and maintains genomic stability under replication stress and DNA damage.
Snippet: ns RPA1 (TP302066), RPA2 (TP305715), MAX (TP320343), ARP3 (TP308460), FANCA (TP761743), XRCC2 (TP308330), DNMT1 (TP326414), MYC (TP301611), NF-κB1 (TP308384) and STAT1 (TP313858) were purchased from OriGene (Rockville, MD). ARP2 (ab217837) was purchased from Abcam (Cambridge, MA). Heterotrimeric RPA and RPA1 mutant forms of RPA were expressed as recombinant protein E. coli and them purified over
FigureFigureFigure
Downregulation of miR-16 via URGCP pathway contributes to glioma growth
Hong, Qing, Ji et al
Sci Rep (2017) 7 (1), 13470 DOI: 10.1038/s41598-017-14035-2
AI Summary: OriGene products—specifically human RALA/p65, URGCP, and c-myc cDNAs—were used to construct expression plasmids that enabled the investigation of the molecular mechanisms underlying glioma growth in this study.
Snippet: …Human RALA/p65, URGCP and c-myc cDNAs were purchased from OriGene (USA) and inserted into pLenti-C-mGFP vectors. ...;... …Human RALA/p65, URGCP and c-myc cDNAs were purchased from OriGene (USA) and inserted into pLenti-C-mGFP vectors.
FigureFigureFigure
Autoantibodies against oncogenic ERG protein in prostate cancer: potential use in diagnosis and prognosis in a panel with C-MYC, AMACR and HERV-K Gag
Rastogi, Ali, Tan et al
Genes Cancer (2016) 7 (11-12), 394-413 DOI: 10.18632/genesandcancer.126
Snippet: Recombinant full length ERG protein, produced in mammalian cells upon transfection of expression plasmid DNA, was purchased from Origene (Rockville, MD). Recombinant proteins for AMACR and cMYC, produced in mammalian cells, were also purchased ... All 2 versions Cite SaveSaving
FigureFigureFigure
Pioneer transcription factors target partial DNA motifs on nucleosomes to initiate reprogramming
Soufi, Garcia, Jaroszewicz et al
Cell (2015) 161 (3), 555-68 DOI: 10.1016/j.cell.2015.03.017
Cited by 855
AI Summary: OriGene contributed mammalian-expressed recombinant human Oct4 (TP311998), Sox2 (TP300757), Klf4 (TP306691), and c-Myc (TP301611) proteins that were used to study how pioneer transcription factors target nucleosomal DNA motifs during cellular reprogramming.
Snippet: Protein Expression and Purification We made the bacterial expression plasmids pET-28B-huOct4, pET-28B-huSox2, pET-28B-huKlf4, and pET-28B-huMyc encoding the full-length human O, S, K, M, respectively, fused to an N-terminal 6× histidine tag. The recombinant proteins were expressed in E. coli Rosetta (DE3) pLysS (Novagen #70956-3) and purified using a nickel charged column under denaturing conditions The mammalian expressed human OSKM recombinant proteins were obtained from OriGene (Oct4 #TP311998, Sox2 #TP300757, Klf4 #TP306691, c-Myc #TP301611). …
Showing 1-6 of 9 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products