OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HMGN4 (NM_006353) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301589
Recombinant protein of human high mobility group nucleosomal binding domain 4 (HMGN4), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HMGN4 or NM_006353"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201589 protein sequence
Red=Cloning site Green=Tags(s)

MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPA
KNRDASTLQSQKAEGTGDAK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 9.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006344
Locus ID 10473
UniProt ID O00479
Cytogenetics 6p22.2
RefSeq Size 1980
RefSeq ORF 270
Synonyms HMG17L3; NHC
Summary The protein encoded by this gene, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. provided by RefSeq, Mar 2013
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HMGN4" proteins (3)
SKU Description Size Price
PH301589 HMGN4 MS Standard C13 and N15-labeled recombinant protein (NP_006344) 10 ug
$3,360.00
LC416708 Lyophilized HMGN4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416708 Transient overexpression lysate of high mobility group nucleosomal binding domain 4 (HMGN4) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products