HMGN4 (NM_006353) Human Mass Spec Standard

SKU PH301589

HMGN4 MS Standard C13 and N15-labeled recombinant protein (NP_006344)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201589]
• Predicted MW: 9.5 kDa
• Protein Sequence:
  Protein Sequence

  >RC201589 protein sequence; Red=Cloning site Green=Tags(s); ; MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPA; KNRDASTLQSQKAEGTGDAK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_006344
• RefSeq Size: 1980
• RefSeq ORF: 270
• Synonyms: HMG17L3; NHC
• Locus ID: 10473
• UniProt ID: O00479
• Cytogenetics: 6p22.2
• Summary: The protein encoded by this gene, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. [provided by RefSeq, Mar 2013]