OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CMTM6 (NM_017801) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301061
Recombinant protein of human CKLF-like MARVEL transmembrane domain containing 6 (CMTM6), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA322304 Anti-CMTM6 Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CMTM6 or NM_017801"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201061 protein sequence
Red=Cloning site Green=Tags(s)

MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYF
FEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVF
GFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060271
Locus ID 54918
UniProt ID Q9NX76
Cytogenetics 3p22.3
RefSeq Size 3384
RefSeq ORF 549
Synonyms CKLFSF6; PRO2219
Summary This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. provided by RefSeq, Jul 2008
Protein Categories Chemokines, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CMTM6" proteins (3)
SKU Description Size Price
PH301061 CMTM6 MS Standard C13 and N15-labeled recombinant protein (NP_060271) 10 ug
$3,360.00
LC413539 Lyophilized CMTM6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413539 Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 6 (CMTM6) (as WB positive control) 100 ug
$436.00

file-alt Citations

Anti-tumor effect of PD-L1-targeting antagonistic aptamer-ASO delivery system with dual inhibitory function in immunotherapy
Luo, Yang, Bai et al
Cell Chem Biol (2023) 30 (11), 1390-1401.e6 DOI: 10.1016/j.chembiol.2023.10.010
Cited by 33
AI Summary: OriGene’s CMTM6 (NM_017801) Human Recombinant Protein (Cat#TP301061) was used in this study to investigate the mechanisms underlying PD-L1 regulation and the efficacy of the PD-L1-targeting aptamer-ASO delivery system in cancer immunotherapy.
Snippet: Recombinant Human PD-1 (C-6His) Novoprotein Cat#CX91 CMTM6 (NM_017801) Human Recombinant Protein ORIGENE Cat#TP301061
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products