CMTM6 (NM_017801) Human Mass Spec Standard

SKU PH301061

CMTM6 MS Standard C13 and N15-labeled recombinant protein (NP_060271)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201061]
• Predicted MW: 20.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC201061 protein sequence; Red=Cloning site Green=Tags(s); ; MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYF; FEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVF; GFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_060271
• RefSeq Size: 3384
• RefSeq ORF: 549
• Synonyms: CKLFSF6; PRO2219
• Locus ID: 54918
• UniProt ID: Q9NX76
• Cytogenetics: 3p22.3
• Summary: This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane