SFXN3 (NM_030971) Human Recombinant Protein

CAT#: TP300974

Recombinant protein of human sideroflexin 3 (SFXN3), 20 µg

Product Images

Coomassie blue staining of purified SFXN3 protein (Cat# TP300974). The protein was produced from HEK293T cells transfected with SFXN3 cDNA clone (Cat# RC200974) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200974 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQ
  LWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRS
  GDTPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAANCINIPLMRQRELQVGIPV
  ADEAGQRLGYSVTAAKQGIFQVVISRICMAIPAMAIPPLIMDTLEKKDFLKRRPWLGAPLQVGLVGFCLV
  FATPLCCALFPQKSSIHISNLEPELRAQIHEQNPSVEVVYYNKGL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_112233
• Locus ID: 81855
• UniProt ID: Q9BWM7, A0A1P0AYU5
• Cytogenetics: 10q24.31
• Refseq Size: 3129
• Refseq ORF: 975
• Synonyms: BA108L7.2; SFX3; SLC56A3
• Summary: Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway (PubMed:30442778). Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors (PubMed:30442778).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane